PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400026672
Common NameLOC102588157
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family MIKC_MADS
Protein Properties Length: 187aa    MW: 21565.8 Da    PI: 10.2342
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400026672genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF91.34.9e-29959151
                          S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                          krien++nrqvtfskRrng+lKKA+ELS+LCdaeva+++fs++gk y ++s
  PGSC0003DMP400026672  9 KRIENQTNRQVTFSKRRNGLLKKAYELSILCDAEVALLLFSPSGKAYNFAS 59
                          79**********************************************986 PP

2K-box57.94.4e-2081157985
                 K-box   9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkek 85 
                           +  + +e ++++++ + + i++L+   +hl Ge+L+sL +keL+qLe+qL  ++++iRskK+++l+e+  +lqk+ +
  PGSC0003DMP400026672  81 QGLRAMEVWRTKIDDMTRTIHELEARDKHLAGEELSSLGMKELKQLERQLRIGVERIRSKKHKILHEENIHLQKQVR 157
                           55667899*****************9***********************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.1E-40160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006632.646161IPR002100Transcription factor, MADS-box
CDDcd002658.94E-39278No hitNo description
SuperFamilySSF554552.49E-31278IPR002100Transcription factor, MADS-box
PRINTSPR004045.0E-31323IPR002100Transcription factor, MADS-box
PfamPF003197.3E-271057IPR002100Transcription factor, MADS-box
PRINTSPR004045.0E-312338IPR002100Transcription factor, MADS-box
PRINTSPR004045.0E-313859IPR002100Transcription factor, MADS-box
PfamPF014861.4E-1585159IPR002487Transcription factor, K-box
PROSITE profilePS5129710.5186186IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 187 aa     Download sequence    Send to blast
MGRGKVELKR IENQTNRQVT FSKRRNGLLK KAYELSILCD AEVALLLFSP SGKAYNFASH  60
DIERTILRYK NEVGLSKNSD QGLRAMEVWR TKIDDMTRTI HELEARDKHL AGEELSSLGM  120
KELKQLERQL RIGVERIRSK KHKILHEENI HLQKQVRLSE IEGSSRILDS EASELLSKGR  180
RIIYDL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P1e-23169169Myocyte-specific enhancer factor 2B
1tqe_Q1e-23169169Myocyte-specific enhancer factor 2B
1tqe_R1e-23169169Myocyte-specific enhancer factor 2B
1tqe_S1e-23169169Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankX607600.0X60760.1 L.esculentum TDR8 mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015166004.11e-132PREDICTED: truncated transcription factor CAULIFLOWER A-like isoform X2
SwissprotP293851e-45AGL5_ARATH; Agamous-like MADS-box protein AGL5
TrEMBLM1B8381e-132M1B838_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000393131e-127(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42830.25e-49MIKC_MADS family protein
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]